Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PELI1 protein

This Human PELI1 protein spans the amino acid sequence from region 1-418aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pellino-related intracellular-signaling molecule (RING-type E3 ubiquitin transferase pellino homolog 1) (Pellino-1) (PRISM)

UniProt

Q96FA3

Expression Region

1-418aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFSPDQENHPSKAPVKYGELIVLGYNGSLPNGDRGRRKSRFALFKRPKANGVKPSTVHIACTPQAAKAISNKDQHSISYTLSRAQTVVVEYTHDSNTDMFQIGRSTESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAAGFDSSKNIFLGEKAAKWKTSDGQMDGLTTNGVLVMHPRNGFTEDSKPGIWREISVCGNVFSLRETRSAQQRGKMVEIETNQLQDGSLIDLCGATLLWRTAEGLSHTPTVKHLEALRQEINAARPQCPVGFNTLAFPSMKRKDVVDEKQPWVYLNCGHVHGYHNWGNKEERDGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTHAFSPCGHVCSEKTTAYWSQIPLPHGTHTFHAACPFCAHQLAGEQGYIRLIFQGPLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPX Polyclonal Antibody
orb3149051-01 50 µg

EPX Polyclonal Antibody

Sign In for Pricing
View Details
EPX Polyclonal Antibody
orb3149051-02 100 µg

EPX Polyclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-1263 miRNA Inhibitor
CIH0789-01 10 nmol

Hsa-miR-1263 miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-1263 miRNA Inhibitor
CIH0789-02 20 nmol

Hsa-miR-1263 miRNA Inhibitor

Sign In for Pricing
View Details
Recombinant Corynebacterium jeikeium Protein CrcB homolog 2 (crcB2)
orb2920049-01 20 µg

Recombinant Corynebacterium jeikeium Protein CrcB homolog 2 (crcB2)

Sign In for Pricing
View Details
Recombinant Corynebacterium jeikeium Protein CrcB homolog 2 (crcB2)
orb2920049-02 100 µg

Recombinant Corynebacterium jeikeium Protein CrcB homolog 2 (crcB2)

Sign In for Pricing
View Details