Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria acpS protein

This Bacteria acpS protein spans the amino acid sequence from region 1-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4'-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)

UniProt

Q48RM7

Expression Region

1-118aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptococcus pyogenes serotype M28 (strain MGAS6180)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish GNAT2 Rabbit Polyclonal Antibody (PE)
orb3003703 100 µg

Zebrafish GNAT2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Human FRS2 (Fibroblast Growth Factor Receptor Substrate 2) ValidElisa Kit
EK341804 96 Well

Human FRS2 (Fibroblast Growth Factor Receptor Substrate 2) ValidElisa Kit

Sign In for Pricing
View Details
GLP-1R Antibody HRP Conjugated
MBS9460747-01 0.1 mL

GLP-1R Antibody HRP Conjugated

Sign In for Pricing
View Details
GLP-1R Antibody HRP Conjugated
MBS9460747-02 5x 0.1 mL

GLP-1R Antibody HRP Conjugated

Sign In for Pricing
View Details
CLM1, NT (CD300LF, CD300F, CLM1, IGSF13, IREM1, NKIR, CMRF35-like molecule 1, CD300 antigen-like family member F, Immune receptor expressed on myeloid cells 1, Immunoglobulin superfamily member 13, NK inhibitory receptor, CD300f) (MaxLight 490) discontinued
034001-ML490 100 µL

CLM1, NT (CD300LF, CD300F, CLM1, IGSF13, IREM1, NKIR, CMRF35-like molecule 1, CD300 antigen-like family member F, Immune receptor expressed on myeloid cells 1, Immunoglobulin superfamily member 13, NK inhibitory receptor, CD300f) (MaxLight 490) discontinued

Sign In for Pricing
View Details
PCOLCE Recombinant Protein (Human)
RP022786 100 µg

PCOLCE Recombinant Protein (Human)

Sign In for Pricing
View Details