Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria acpS protein

This Bacteria acpS protein spans the amino acid sequence from region 1-118aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4'-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)

UniProt

Q48RM7

Expression Region

1-118aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Streptococcus pyogenes serotype M28 (strain MGAS6180)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmu-miR-7055-5p miRNA Inhibitor
orb1869339-01 10 nmol

Mmu-miR-7055-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7055-5p miRNA Inhibitor
orb1869339-02 20 nmol

Mmu-miR-7055-5p miRNA Inhibitor

Sign In for Pricing
View Details
PSMD6 antibody
70R-50748 100 µL

PSMD6 antibody

Sign In for Pricing
View Details
HnRNP C1/2 Rabbit Polyclonal Antibody
APRab12138-01 20 µL

HnRNP C1/2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HnRNP C1/2 Rabbit Polyclonal Antibody
APRab12138-02 50 µL

HnRNP C1/2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HnRNP C1/2 Rabbit Polyclonal Antibody
APRab12138-03 100 µL

HnRNP C1/2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details