Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria btuD protein

This Bacteria btuD protein spans the amino acid sequence from region 1-398aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vitamin B12-transporting ATPase

UniProt

B0R5G4

Expression Region

1-398aa

Tag

Tag-Free

Source

E.coli

Origin

Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVGPNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALSSAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHTTRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGGERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRTLEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVVADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPATGAVTVTPLPDRTSAAADTSVHVVGGGDSATPVVRRLVSAGASVSVGPVVEGDTDHETARRVGCPCTSVAPFTRLEDTTAASATRADIAAADVIAVPVAAAARPGVRGLLTGAVPTLAVGDAAGAPEWADRLVACDAVVSAVGALADTPSDGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein B (Apo B) (HRP) discontinued
A2299-38E-HRP 100 µL

Apolipoprotein B (Apo B) (HRP) discontinued

Sign In for Pricing
View Details
Lentiviral human C9orf64 shRNA (UAS) - Lentiviral human C9orf64 shRNA (UAS) plasmid
GTR15084619 1 Vial

Lentiviral human C9orf64 shRNA (UAS) - Lentiviral human C9orf64 shRNA (UAS) plasmid

Sign In for Pricing
View Details
ERVMER34-1 Rabbit Polyclonal Antibody
orb3071834-01 30 µL

ERVMER34-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERVMER34-1 Rabbit Polyclonal Antibody
orb3071834-02 50 µL

ERVMER34-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERVMER34-1 Rabbit Polyclonal Antibody
orb3071834-03 100 µL

ERVMER34-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ERVMER34-1 Rabbit Polyclonal Antibody
orb3071834-04 200 µL

ERVMER34-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details