Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ctsl protein

This Mouse Ctsl protein spans the amino acid sequence from region 114-288aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cathepsin L (Major excreted protein) (MEP) (p39 cysteine proteinase) (Ctsl1)

UniProt

P06797

Expression Region

114-288aa

Tag

N-terminal 6xHis-taggedand C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPKSVDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLVDCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEFAVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSKNLDHGVLLVGYGYEGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PKC beta 1 Rabbit Monoclonal Antibody
M01940-2 100 µL/Vial

Anti-PKC beta 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pin1 shRNA (UAS) - Lentiviral mouse Pin1 shRNA (UAS, iRFP) plasmid
GTR15215512 1 Vial

Lentiviral mouse Pin1 shRNA (UAS) - Lentiviral mouse Pin1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Pep2-SVKI
TP1944 2 mg

Pep2-SVKI

Sign In for Pricing
View Details
Kinesis Syringe 1ml; RN; Prefitted Push-Pull Valve
CHR1603 1 Each

Kinesis Syringe 1ml; RN; Prefitted Push-Pull Valve

Sign In for Pricing
View Details
3-Oxoacid Coenzyme A Transferase 1 (OXCT1), Recombinant, Human, His-Tag
056003-01 10 µg

3-Oxoacid Coenzyme A Transferase 1 (OXCT1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
3-Oxoacid Coenzyme A Transferase 1 (OXCT1), Recombinant, Human, His-Tag
056003-02 50 µg

3-Oxoacid Coenzyme A Transferase 1 (OXCT1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details