Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria dsbA protein

This Bacteria dsbA protein spans the amino acid sequence from region 1-89aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DsDNA-binding protein A (rpbB)

UniProt

P13320

Expression Region

1-89aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hmgcs1 (NM_145942) Mouse Untagged Clone
MC201940 10 µg

Hmgcs1 (NM_145942) Mouse Untagged Clone

Sign In for Pricing
View Details
Anti-GMDS Antibody
A05783-1 100 µg/Vial

Anti-GMDS Antibody

Sign In for Pricing
View Details
Faropenem Impurity 43
RM-F181643-01 10 mg

Faropenem Impurity 43

Sign In for Pricing
View Details
Faropenem Impurity 43
RM-F181643-02 25 mg

Faropenem Impurity 43

Sign In for Pricing
View Details
Faropenem Impurity 43
RM-F181643-03 50 mg

Faropenem Impurity 43

Sign In for Pricing
View Details
Faropenem Impurity 43
RM-F181643-04 100 mg

Faropenem Impurity 43

Sign In for Pricing
View Details