Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria dsbA protein

This Bacteria dsbA protein spans the amino acid sequence from region 1-89aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DsDNA-binding protein A (rpbB)

UniProt

P13320

Expression Region

1-89aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Enterobacteria phage T4 (Bacteriophage T4)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKKEMVEFDEAIHGEDLAKFIKEASDHKLKISGYNELIKDIRIRAKDELGVDGKMFNRLLALYHKDNRDVFEAETEEVVELYDTVFSK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAI-1 (m) -PR
sc-36180-PR 10 µM - 20 µL

PAI-1 (m) -PR

Sign In for Pricing
View Details
EDA, NT (Ectodysplasin-A, Ectodermal Dysplasia Protein, EDA Protein, ED1, EDA2) (MaxLight 750) discontinued
E2053-30A-ML750 100 µL

EDA, NT (Ectodysplasin-A, Ectodermal Dysplasia Protein, EDA Protein, ED1, EDA2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
IGF1R (Phospho-Tyr1161) Antibody
MBS9519036-01 0.05 mL

IGF1R (Phospho-Tyr1161) Antibody

Sign In for Pricing
View Details
IGF1R (Phospho-Tyr1161) Antibody
MBS9519036-02 0.1 mL

IGF1R (Phospho-Tyr1161) Antibody

Sign In for Pricing
View Details
IGF1R (Phospho-Tyr1161) Antibody
MBS9519036-03 5x 0.1 mL

IGF1R (Phospho-Tyr1161) Antibody

Sign In for Pricing
View Details
D-3263 10mg
A20935-10 10 mg

D-3263 10mg

Sign In for Pricing
View Details