Fungi Lentinula edodes Serine protease inhibitor protein
This Fungi Lentinula edodes Serine protease inhibitor protein spans the amino acid sequence from region 1-142aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Serine protease inhibitor
UniProt
P81639
Expression Region
1-142aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Lentinula edodes (Shiitake mushroom) (Lentinus edodes)
Field of Research
Infectious Disease & Virology; Pharmacology & Drug Discovery
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SLETGRYLIHNGNNIVSRNLAEDRSLNPKRIVLLEPTDKIQLTWIIEKSGDEYILNNRGAPTAHIEDHVFALLIHQEGATKWSIEAVPRHGRNAYIIKGSDGKGWVAPDKAGEQIIYRTLIVGPSEPPTFPLNQVFQIIKLE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400226-100 1x 100 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400950-100 1x 100 µL
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680757-500 1x 500 µL
Cytokeratin 7 (K72.7), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details