Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHRNA3 protein

This Human CHRNA3 protein spans the amino acid sequence from region 32-240aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NACHRA3

UniProt

P32297

Expression Region

32-240aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Thermocellum purH Protein (aa 1-514)
VAng-Lsx02026-inquire Inquire

Recombinant Clostridium Thermocellum purH Protein (aa 1-514)

Sign In for Pricing
View Details
Biotin Phosphoramidite
6006-AAT 1 g

Biotin Phosphoramidite

Sign In for Pricing
View Details
C9orf38 Human shRNA Plasmid Kit (Locus ID 29044)
TR317126 1 Kit

C9orf38 Human shRNA Plasmid Kit (Locus ID 29044)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Eukaryotic translation initiation factor 3 subunit B (eIF3-S9), partial
MBS1443202 Inquire

Recombinant Drosophila melanogaster Eukaryotic translation initiation factor 3 subunit B (eIF3-S9), partial

Sign In for Pricing
View Details
Bovine transforming growth factor beta receptor 2 (TGFbR2) ELISA Kit
GTR10343438 96 Well

Bovine transforming growth factor beta receptor 2 (TGFbR2) ELISA Kit

Sign In for Pricing
View Details
TTR/Prealbumin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-0152R-BF750-TR 20 µL

TTR/Prealbumin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details