What is the catalog number for Rat Prss2 protein?

The catalog number for Rat Prss2 protein is orb605373.

What sizes are available for Rat Prss2 protein?

Rat Prss2 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Rat Prss2 protein come in?

Rat Prss2 protein is available in 3 different pack sizes.

Is Rat Prss2 protein in stock?

Rat Prss2 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Rat Prss2 protein

This Rat Prss2 protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anionic trypsin II (Pretrypsinogen II) (Serine protease 2) (Try2)

UniProt

P00763

Expression Region

24-246aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN