Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli traY protein

This E. coli traY protein spans the amino acid sequence from region 1-75aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TraY, Relaxosome protein TraY

UniProt

P10512

Expression Region

1-75aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRRRNARGGISRTVSVYLDEDTNNRLIRAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVIEENESTFKEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UQCRC1 (Cytochrome b-c1 Complex Subunit 1, Mitochondrial, Complex III Subunit 1, Core Protein I, Ubiquinol-cytochrome-c Reductase Complex Core Protein 1) (MaxLight 650)
MBS6398081-01 0.1 mL

UQCRC1 (Cytochrome b-c1 Complex Subunit 1, Mitochondrial, Complex III Subunit 1, Core Protein I, Ubiquinol-cytochrome-c Reductase Complex Core Protein 1) (MaxLight 650)

Sign In for Pricing
View Details
UQCRC1 (Cytochrome b-c1 Complex Subunit 1, Mitochondrial, Complex III Subunit 1, Core Protein I, Ubiquinol-cytochrome-c Reductase Complex Core Protein 1) (MaxLight 650)
MBS6398081-02 5x 0.1 mL

UQCRC1 (Cytochrome b-c1 Complex Subunit 1, Mitochondrial, Complex III Subunit 1, Core Protein I, Ubiquinol-cytochrome-c Reductase Complex Core Protein 1) (MaxLight 650)

Sign In for Pricing
View Details
NPR3 Antibody
orb2673104-01 50 µL

NPR3 Antibody

Sign In for Pricing
View Details
NPR3 Antibody
orb2673104-02 100 µL

NPR3 Antibody

Sign In for Pricing
View Details
NPR3 Antibody
orb2673104-03 200 µL

NPR3 Antibody

Sign In for Pricing
View Details
Clns1a Rabbit Polyclonal Antibody
orb581505 100 µL

Clns1a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details