Virus vpr protein
This Virus vpr protein spans the amino acid sequence from region 1-96aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
R ORF protein (Viral protein R)
UniProt
P0C1P2
Expression Region
1-96aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) (HIV-1)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9909842-01 48 Well
Horse Period Circadian Protein Homolog 2 (PER2) ELISA Kit
Sign In for Pricing
View Details MBS9909842-02 96 Well
Horse Period Circadian Protein Homolog 2 (PER2) ELISA Kit
Sign In for Pricing
View Details MBS9909842-03 5x 96 Well
Horse Period Circadian Protein Homolog 2 (PER2) ELISA Kit
Sign In for Pricing
View Details MBS9909842-04 10x 96 Well
Horse Period Circadian Protein Homolog 2 (PER2) ELISA Kit
Sign In for Pricing
View Details 
249254-PE 100 µL
NEUROG2 (Neurogenin 2, Atoh4, MGC46562, Math4A, NGN2, bHLHa8, ngn-2) (PE)
Sign In for Pricing
View Details