Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria pscF protein

This Bacteria pscF protein spans the amino acid sequence from region 2-85aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pseudomonas secretion protein F

UniProt

P95434

Expression Region

2-85aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CYB5R4 shRNA (UAS) - Lentiviral human CYB5R4 shRNA (UAS, GFP) plasmid
GTR15099994 1 Vial

Lentiviral human CYB5R4 shRNA (UAS) - Lentiviral human CYB5R4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Mouse CD33 Recombinant Protein (C-Fc)
MB185021-01 50 µg

Mouse CD33 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Mouse CD33 Recombinant Protein (C-Fc)
MB185021-02 100 µg

Mouse CD33 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Mouse CD33 Recombinant Protein (C-Fc)
MB185021-03 1 mg

Mouse CD33 Recombinant Protein (C-Fc)

Sign In for Pricing
View Details
Refill 3 Rolls of 5 M of Ph 0.5-5.0 Paper
PHZ055U 1 Each

Refill 3 Rolls of 5 M of Ph 0.5-5.0 Paper

Sign In for Pricing
View Details
Glucose 6 phosphatase, catalytic subunit (G6PC) Human Over-expression Lysate
orb1361943 20 µg

Glucose 6 phosphatase, catalytic subunit (G6PC) Human Over-expression Lysate

Sign In for Pricing
View Details