Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Adamts13 protein

This Mouse Adamts13 protein spans the amino acid sequence from region 904-1137aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Von Willebrand factor-cleaving protease (vWF-CP) (vWF-cleaving protease) (ADAM-TS 13) (ADAM-TS13) (ADAMTS-13) (Gm710)

UniProt

Q769J6

Expression Region

904-1137aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR32 Antibody
orb1533595 50 µg

GPR32 Antibody

Sign In for Pricing
View Details
Anti-Apolipoprotein E, E3, mouse mab
61086 50 µg

Anti-Apolipoprotein E, E3, mouse mab

Sign In for Pricing
View Details
Mouse Monoclonal Mouse anti-Human IgG Fc Secondary Antibody (EM-07) [DyLight 550]
NBP1-45063R 0.1 mL

Mouse Monoclonal Mouse anti-Human IgG Fc Secondary Antibody (EM-07) [DyLight 550]

Sign In for Pricing
View Details
Rat Immunoglobulin E (IgE) ELISA Kit
SL0361Ra-01 48 Tests

Rat Immunoglobulin E (IgE) ELISA Kit

Sign In for Pricing
View Details
Rat Immunoglobulin E (IgE) ELISA Kit
SL0361Ra-02 96 Tests

Rat Immunoglobulin E (IgE) ELISA Kit

Sign In for Pricing
View Details
Locked Analog T 5 umol scale
26-6520-06 1 Each

Locked Analog T 5 umol scale

Sign In for Pricing
View Details