Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Adamts13 protein

This Mouse Adamts13 protein spans the amino acid sequence from region 904-1137aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Von Willebrand factor-cleaving protease (vWF-CP) (vWF-cleaving protease) (ADAM-TS 13) (ADAM-TS13) (ADAMTS-13) (Gm710)

UniProt

Q769J6

Expression Region

904-1137aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDOC Blocking Peptide
CBP3763-01 1 mg

ALDOC Blocking Peptide

Sign In for Pricing
View Details
ALDOC Blocking Peptide
CBP3763-02 5 mg

ALDOC Blocking Peptide

Sign In for Pricing
View Details
10× Transcription Buffer GMP-grade
10627ES25 25 mL

10× Transcription Buffer GMP-grade

Sign In for Pricing
View Details
Human NCR2 knockout cell line
ABC-KH9920 1 Vial

Human NCR2 knockout cell line

Sign In for Pricing
View Details
PTP zeta Polyclonal Antibody, Cy3 Conjugated
bs-11327R-Cy3 100 µL

PTP zeta Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Vasorin (VASN, Protein Slit-like 2, SLITL2, UNQ314/PRO357/PRO1282) (Biotin)
MBS6398251-01 0.1 mL

Vasorin (VASN, Protein Slit-like 2, SLITL2, UNQ314/PRO357/PRO1282) (Biotin)

Sign In for Pricing
View Details