Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Adamts13 protein

This Mouse Adamts13 protein spans the amino acid sequence from region 904-1137aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Von Willebrand factor-cleaving protease (vWF-CP) (vWF-cleaving protease) (ADAM-TS 13) (ADAM-TS13) (ADAMTS-13) (Gm710)

UniProt

Q769J6

Expression Region

904-1137aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal RBPMS Antibody (OTI3B7) [PE]
NBP2-73836PE 0.1 mL

Mouse Monoclonal RBPMS Antibody (OTI3B7) [PE]

Sign In for Pricing
View Details
pCDNA3.1(+)-2019-nCoV-N Plasmid
PVT19759 2 µg

pCDNA3.1(+)-2019-nCoV-N Plasmid

Sign In for Pricing
View Details
MRPS28 (NM_014018) Human Mass Spec Standard
PH303975 10 µg

MRPS28 (NM_014018) Human Mass Spec Standard

Sign In for Pricing
View Details
HHV14 UL38 Rabbit Polyclonal Antibody
E10G32465 100 µL

HHV14 UL38 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAJ11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV787291 1.0 µg DNA

TRAJ11 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rabbit Elongation factor 2 (EEF2) ELISA Kit
MBS282802-01 48 Tests

Rabbit Elongation factor 2 (EEF2) ELISA Kit

Sign In for Pricing
View Details