Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tet2 protein

This Mouse Tet2 protein spans the amino acid sequence from region 1810-1912aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Ayu17-449 (Kiaa1546)

UniProt

Q4JK59

Expression Region

1810-1912aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RISLVLYRHKNLFLPKHCLALWEAKMAEKARKEEECGKNGSDHVSQKNHGKQEKREPTGPQEPSYLRFIQSLAENTGSVTTDSTVTTSPYAFTQVTGPYNTFV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Thioredoxin 2/TXN2 Antibody Picoband® (monoclonal, 7B5), HRP Conjugate
M04586-1-HRP 100 µg/Vial

Anti-Thioredoxin 2/TXN2 Antibody Picoband® (monoclonal, 7B5), HRP Conjugate

Sign In for Pricing
View Details
Anti-TCPTP/PTPN2 Antibody Picoband
MBS1754946-01 0.01 mg

Anti-TCPTP/PTPN2 Antibody Picoband

Sign In for Pricing
View Details
Anti-TCPTP/PTPN2 Antibody Picoband
MBS1754946-02 0.1 mg (Carrier Free)

Anti-TCPTP/PTPN2 Antibody Picoband

Sign In for Pricing
View Details
Anti-TCPTP/PTPN2 Antibody Picoband
MBS1754946-03 0.1 mg

Anti-TCPTP/PTPN2 Antibody Picoband

Sign In for Pricing
View Details
Anti-TCPTP/PTPN2 Antibody Picoband
MBS1754946-04 0.1 mg (Cy3)

Anti-TCPTP/PTPN2 Antibody Picoband

Sign In for Pricing
View Details
Anti-TCPTP/PTPN2 Antibody Picoband
MBS1754946-05 0.1 mg (Biotin)

Anti-TCPTP/PTPN2 Antibody Picoband

Sign In for Pricing
View Details