Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fungi sodC protein

This Fungi sodC protein spans the amino acid sequence from region 1-120aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SodC, Superoxide dismutase [Cu-Zn], EC 1.15.1.1, Fragment

UniProt

Q12548

Expression Region

1-120aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Aspergillus japonicus

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSSSVPLHGFHVHALGDTTNGCMSTGPHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVHADPDDLGKGGHELSKTTGNSNSSMDSCAHGIQGIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rgl2 Mouse Gene Knockout Kit (CRISPR)
KN514719 1 Kit

Rgl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IFNW1 (NM_002177) Human Over-expression Lysate
LY419484 100 µg

IFNW1 (NM_002177) Human Over-expression Lysate

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2790), CF647 conjugate, 0.1mg/mL
BNC472790-500 1x 500 µL

CD63 (Late Endosomes Marker) (LAMP3/2790), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human ANKRD11 activation kit by CRISPRa
GA109253 1 Kit

Human ANKRD11 activation kit by CRISPRa

Sign In for Pricing
View Details
(±)-Alpha-Bisabolol-d3 (racemic and diastereomeric mixture)
TRC-B399808-5MG 5 mg

(±)-Alpha-Bisabolol-d3 (racemic and diastereomeric mixture)

Sign In for Pricing
View Details
C20orf7 (NDUFAF5) (NM_001039375) Human Recombinant Protein
TP760234 50 µg

C20orf7 (NDUFAF5) (NM_001039375) Human Recombinant Protein

Sign In for Pricing
View Details