What is the catalog number for Fungi sar protein?

The catalog number for Fungi sar protein is orb604804.

What sizes are available for Fungi sar protein?

Fungi sar protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Fungi sar protein come in?

Fungi sar protein is available in 3 different pack sizes.

Is Fungi sar protein in stock?

Fungi sar protein is currently made to order / not held in immediate stock. Contact us for lead time.

Fungi sar protein

This Fungi sar protein spans the amino acid sequence from region 28-177aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RRNA endonuclease

UniProt

P00655

Expression Region

28-177aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Aspergillus giganteus

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVTWTCLNDQKNPKTNKYETKRLLYNQNKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLPKGRTPIKFGKSDCDRPPKHSKDGNGKTDHYLLEFPTFPDGHDYKFDSKKPKENPGPARVIYTYPNKVFCGIIAHTKENQGELKLCSH