Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOC1 protein

This Human APOC1 protein spans the amino acid sequence from region 27-83aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apolipoprotein C1 (Apo-CI) (ApoC-I)

UniProt

P02654

Expression Region

27-83aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salinispora arenicola Ribonuclease PH (rph)
MBS1090143-01 0.02 mg (E-Coli)

Recombinant Salinispora arenicola Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Ribonuclease PH (rph)
MBS1090143-02 0.1 mg (E-Coli)

Recombinant Salinispora arenicola Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Ribonuclease PH (rph)
MBS1090143-03 0.02 mg (Yeast)

Recombinant Salinispora arenicola Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Ribonuclease PH (rph)
MBS1090143-04 0.1 mg (Yeast)

Recombinant Salinispora arenicola Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Ribonuclease PH (rph)
MBS1090143-05 0.02 mg (Baculovirus)

Recombinant Salinispora arenicola Ribonuclease PH (rph)

Sign In for Pricing
View Details
Recombinant Salinispora arenicola Ribonuclease PH (rph)
MBS1090143-06 0.02 mg (Mammalian-Cell)

Recombinant Salinispora arenicola Ribonuclease PH (rph)

Sign In for Pricing
View Details