Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus US12 protein

This Virus US12 protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)

UniProt

P60504

Expression Region

1-78aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Herpes simplex virus type 2 (strain SA8) (Simian agent 8)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL7 Protein Vector (Rat) (pPB-C-His)
PV258238 500 ng

CCL7 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rat Phosphodiesterase 12 (PDE12) ELISA Kit
MBS457121-01 48 Tests

Rat Phosphodiesterase 12 (PDE12) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphodiesterase 12 (PDE12) ELISA Kit
MBS457121-02 96 Tests

Rat Phosphodiesterase 12 (PDE12) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphodiesterase 12 (PDE12) ELISA Kit
MBS457121-03 5x 96 Tests

Rat Phosphodiesterase 12 (PDE12) ELISA Kit

Sign In for Pricing
View Details
Rat Phosphodiesterase 12 (PDE12) ELISA Kit
MBS457121-04 10x 96 Tests

Rat Phosphodiesterase 12 (PDE12) ELISA Kit

Sign In for Pricing
View Details
LX-1031
BUP04298-01 5 mg

LX-1031

Sign In for Pricing
View Details