Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus US12 protein

This Virus US12 protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)

UniProt

P60504

Expression Region

1-78aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Herpes simplex virus type 2 (strain SA8) (Simian agent 8)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPF3 Blocking Peptide
MBS9626713-01 1 mg

PRPF3 Blocking Peptide

Sign In for Pricing
View Details
PRPF3 Blocking Peptide
MBS9626713-02 5x 1 mg

PRPF3 Blocking Peptide

Sign In for Pricing
View Details
Hsa-miR-6844 miRNA Antagomir
CIJ2352-01 10 nmol

Hsa-miR-6844 miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-6844 miRNA Antagomir
CIJ2352-02 20 nmol

Hsa-miR-6844 miRNA Antagomir

Sign In for Pricing
View Details
C6orf138 Antibody
abx026241-01 80 µL

C6orf138 Antibody

Sign In for Pricing
View Details
C6orf138 Antibody
abx026241-02 400 µL

C6orf138 Antibody

Sign In for Pricing
View Details