Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus US12 protein

This Virus US12 protein spans the amino acid sequence from region 1-78aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)

UniProt

P60504

Expression Region

1-78aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Herpes simplex virus type 2 (strain SA8) (Simian agent 8)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSLYLATVDAFLRNPHTRHRTCADLRRELDAYADEERREAAKAIAHPDRPLLAPPSAPPNHSHLAARETAPPPAATP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse REM2- and Rab-like small GTPase 1 (CPLANE2) ELISA Kit
abx543708 96 Tests

Mouse REM2- and Rab-like small GTPase 1 (CPLANE2) ELISA Kit

Sign In for Pricing
View Details
Canine Basic Salivary Proline Rich Protein 1 ELISA Kit
MBS067044-01 48 Well

Canine Basic Salivary Proline Rich Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Basic Salivary Proline Rich Protein 1 ELISA Kit
MBS067044-02 96 Well

Canine Basic Salivary Proline Rich Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Basic Salivary Proline Rich Protein 1 ELISA Kit
MBS067044-03 5x 96 Well

Canine Basic Salivary Proline Rich Protein 1 ELISA Kit

Sign In for Pricing
View Details
Canine Basic Salivary Proline Rich Protein 1 ELISA Kit
MBS067044-04 10x 96 Well

Canine Basic Salivary Proline Rich Protein 1 ELISA Kit

Sign In for Pricing
View Details
Duck Hemochromatosis Type 2/Uvenile-Uman Homolog ELISA Kit
MBS068900 Inquire

Duck Hemochromatosis Type 2/Uvenile-Uman Homolog ELISA Kit

Sign In for Pricing
View Details