Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Scgb1c1 protein

This Mouse Scgb1c1 protein spans the amino acid sequence from region 24-95aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Secretoglobin RYD5 (Ryd5)

UniProt

Q7M742

Expression Region

24-95aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDDNEFFMEFLQTLLVGTPEELYEGPLGKYNVNDMAKSALRELKSCIDELQPVHKEQLVKLLVQVLDAQEDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD49b/VLA-2a Antibody : FITC
OASB00615-500UG 0.5 mg

Mouse CD49b/VLA-2a Antibody : FITC

Sign In for Pricing
View Details
Rabbit Polyclonal to Human HAVCR1 / KIM-1
MBS242060-01 0.05 mg

Rabbit Polyclonal to Human HAVCR1 / KIM-1

Sign In for Pricing
View Details
Rabbit Polyclonal to Human HAVCR1 / KIM-1
MBS242060-02 5x 0.05 mg

Rabbit Polyclonal to Human HAVCR1 / KIM-1

Sign In for Pricing
View Details
[Glu3,4,7,10,14]-Conantokin G
E-PP-0198-01 1 mg

[Glu3,4,7,10,14]-Conantokin G

Sign In for Pricing
View Details
[Glu3,4,7,10,14]-Conantokin G
E-PP-0198-02 10 mg

[Glu3,4,7,10,14]-Conantokin G

Sign In for Pricing
View Details
[Glu3,4,7,10,14]-Conantokin G
E-PP-0198-03 5 mg

[Glu3,4,7,10,14]-Conantokin G

Sign In for Pricing
View Details