Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria Moraxella bovis Fimbrial protein 1 protein

This Bacteria Moraxella bovis Fimbrial protein 1 protein spans the amino acid sequence from region 7-159aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-pilin (Fimbrial protein I) (I pilin)

UniProt

P20657

Expression Region

7-159aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Moraxella bovis

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FTLIELMIVIAIIGILAAIALPAYQDYISKSQTTRVSGELAAGKTAVDAALFEGKTPVLSEESSTSKENIGLTSSETSTKPRSNLMASVELTGFADNGAGTISATLGNKANKDIAKTVITQERTTDGVWTCKIDGSQAAKYKEKFNPTGCVKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-100 1x 100 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
BNC050391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL
BNC881953-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (ERB2/776), CF488A conjugate, 0.1mg/mL
BNC880776-500 1x 500 µL

HER-2 / CD340 (ERB2/776), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF568 conjugate, 0.1mg/mL
BNC680500-500 1x 500 µL

Progesterone Receptor (PR500), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF488A conjugate, 0.1mg/mL
BNC882085-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details