Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hamster PRDX1 protein

This Hamster PRDX1 protein spans the amino acid sequence from region 2-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thioredoxin peroxidase 2 (TPX-2) (TDPX2)

UniProt

Q9JKY1

Expression Region

2-199aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KANSL1 Antibody, HRP conjugated
A59530-100UG 100 µg

KANSL1 Antibody, HRP conjugated

Sign In for Pricing
View Details
UHRF2 Polyclonal Antibody
E913602 100 µL

UHRF2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CATSPER1, GST-tagged
CATSPER1-10746H 25 µg

Recombinant Human CATSPER1, GST-tagged

Sign In for Pricing
View Details
Human SAP Protein, His Tag
MBS189584-01 0.01 mg

Human SAP Protein, His Tag

Sign In for Pricing
View Details
Human SAP Protein, His Tag
MBS189584-02 0.05 mg

Human SAP Protein, His Tag

Sign In for Pricing
View Details
Human SAP Protein, His Tag
MBS189584-03 0.1 mg

Human SAP Protein, His Tag

Sign In for Pricing
View Details