Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hamster PRDX1 protein

This Hamster PRDX1 protein spans the amino acid sequence from region 2-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thioredoxin peroxidase 2 (TPX-2) (TDPX2)

UniProt

Q9JKY1

Expression Region

2-199aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PDIA4 (Protein Disulfide Isomerase A4) ELISA Kit
ELK4325-01 48 Tests

Human PDIA4 (Protein Disulfide Isomerase A4) ELISA Kit

Sign In for Pricing
View Details
Human PDIA4 (Protein Disulfide Isomerase A4) ELISA Kit
ELK4325-02 96 Tests

Human PDIA4 (Protein Disulfide Isomerase A4) ELISA Kit

Sign In for Pricing
View Details
Human PDIA4 (Protein Disulfide Isomerase A4) ELISA Kit
ELK4325-03 5x 96 Tests

Human PDIA4 (Protein Disulfide Isomerase A4) ELISA Kit

Sign In for Pricing
View Details
ACTN2 (NM_001103) Human 3' UTR Clone
SC215765 10 µg

ACTN2 (NM_001103) Human 3' UTR Clone

Sign In for Pricing
View Details
MMP14 Antibody, mAb, Rabbit
A02633-100 100 µL

MMP14 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
PIK3R1 (GRB1, Phosphatidylinositol 3-kinase Regulatory Subunit alpha, Phosphatidylinositol 3-kinase 85kD Regulatory Subunit alpha) (MaxLight 490)
131344-ML490 100 µL

PIK3R1 (GRB1, Phosphatidylinositol 3-kinase Regulatory Subunit alpha, Phosphatidylinositol 3-kinase 85kD Regulatory Subunit alpha) (MaxLight 490)

Sign In for Pricing
View Details