Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus VACWR156 protein

This Virus VACWR156 protein spans the amino acid sequence from region 57-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VACWR156, A33RProtein A33

UniProt

P68617

Expression Region

57-185aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), CF568 conjugate, 0.1mg/mL
BNC682838-100 1x 100 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2838), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IGFBP2, C-His Tag
HA211103-01 20 µg

Human IGFBP2, C-His Tag

Sign In for Pricing
View Details
Human IGFBP2, C-His Tag
HA211103-02 50 µg

Human IGFBP2, C-His Tag

Sign In for Pricing
View Details
Human IGFBP2, C-His Tag
HA211103-03 100 µg

Human IGFBP2, C-His Tag

Sign In for Pricing
View Details
Peroxiredoxin 5 Recombinant Rabbit monoclonal Antibody
HA750915 100 µL

Peroxiredoxin 5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HypoGel® 400 FMP
SP400110150160.100G 100 g

HypoGel® 400 FMP

Sign In for Pricing
View Details