Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus VACWR156 protein

This Virus VACWR156 protein spans the amino acid sequence from region 57-185aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VACWR156, A33RProtein A33

UniProt

P68617

Expression Region

57-185aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRLNQCMSANEAAITDAAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYQLFSDAKANCTAESSTLPNKSDVLITWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCVKTMN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hieff NGS™ Novel DNA Ligation Module for kit
12805ES96 96 Tests

Hieff NGS™ Novel DNA Ligation Module for kit

Sign In for Pricing
View Details
Ube2z Mouse Gene Knockout Kit (CRISPR)
KN518596 1 Kit

Ube2z Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slamf6 Mouse Gene Knockout Kit (CRISPR)
KN515847 1 Kit

Slamf6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3-Hydroxycyclohexane-1-carboxylic acid
TRC-H950113-250MG 250 mg

3-Hydroxycyclohexane-1-carboxylic acid

Sign In for Pricing
View Details
Stathmin 1 (STMN1) pSer37 Rabbit Polyclonal Antibody
AP02484PU-N 100 µL

Stathmin 1 (STMN1) pSer37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCDC46 (CEP112) Human Gene Knockout Kit (CRISPR)
KN419337 1 Kit

CCDC46 (CEP112) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details