Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Dock8 protein

This Mouse Dock8 protein spans the amino acid sequence from region 1633-2067aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dock8Dedicator of cytokinesis protein 8

UniProt

Q8C147

Expression Region

1633-2067aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSYQASPDLRLTWLQNMAEKHTKKKCFTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDNIINKDHKRMFGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIERKIP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPRBP (DCAF1) (NM_001171904) Human Tagged Lenti ORF Clone
RC230723L3 10 µg

VPRBP (DCAF1) (NM_001171904) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
VPS35 Antibody, Clone 8A3: ATTO 390
SMC-604D-A390 100 µg

VPS35 Antibody, Clone 8A3: ATTO 390

Sign In for Pricing
View Details
Recombinant Human NCR3 / NKp300 Protein (His tag)
E53A06672 50 µg

Recombinant Human NCR3 / NKp300 Protein (His tag)

Sign In for Pricing
View Details
Dgkg Rat siRNA Oligo Duplex (Locus ID 25666)
SR503066 1 Kit

Dgkg Rat siRNA Oligo Duplex (Locus ID 25666)

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit
MBS9399143-01 48 Strip Well

Hamster Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit
MBS9399143-02 96 Strip Well

Hamster Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit

Sign In for Pricing
View Details