Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Dock8 protein

This Mouse Dock8 protein spans the amino acid sequence from region 1633-2067aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dock8Dedicator of cytokinesis protein 8

UniProt

Q8C147

Expression Region

1633-2067aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSYQASPDLRLTWLQNMAEKHTKKKCFTEAAMCLVHAAALVAEYLSMLEDHSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFSTGGLYETVNEVYKLVIPILEAHRDFRKLTSTHDKLQKAFDNIINKDHKRMFGTYFRVGFYGSRFGDLDEQEFVYKEPAITKLPEISHRLEGFYGQCFGAEFVEVIKDSTPVDKTKLDPNKAYIQITFVEPYFDEYEMKDRVTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQHRRNTVLTTMHAFPYIKTRIRVSQKEEFVLTPIEVAIEDMKKKTLQLAVATHQEPPDAKMLQMVLQGSVGATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNRRLITAEQREYQQELKKNYNKLRDSLRPMIERKIP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DFFB Protein Vector (Human) (pPM-C-HA)
PV072843 500 ng

DFFB Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
NR1D2 Mouse Monoclonal Antibody [Clone:4G1]
E45M17317 100 µg

NR1D2 Mouse Monoclonal Antibody [Clone:4G1]

Sign In for Pricing
View Details
EDN3 Antibody
A44401-50UL 50 μL

EDN3 Antibody

Sign In for Pricing
View Details
PHD2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-3686R-BF750 100 µL

PHD2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Anti-Zebrafish PSMA1 Antibody Picoband® HRP Conjugated
AZQ6DGX8-HRP 100 µg/Vial

Anti-Zebrafish PSMA1 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
GPR3 Rabbit Polyclonal Antibody (Fluoro550)
orb3100717 100 µg

GPR3 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details