Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli lpp protein

This E. coli lpp protein spans the amino acid sequence from region 21-78aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Braun lipoprotein (Murein-lipoprotein) (mlpA) (mulI)

UniProt

P69776

Expression Region

21-78aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DRG1 Antibody, FITC conjugated
A72542-100UG 100 µg

DRG1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Smarcc1 (NM_001106861) Rat Tagged ORF Clone Lentiviral Particle
RR213211L4V 200 µL

Smarcc1 (NM_001106861) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (AP)
MBS6163027-01 0.1 mL

NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (AP)

Sign In for Pricing
View Details
NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (AP)
MBS6163027-02 5x 0.1 mL

NME2 (Non-Metastatic Cells 2, Protein (NM23B) Expressed in, MGC111212, NDPK-B, NDPKB, NM23-H2, NM23B, puf) (AP)

Sign In for Pricing
View Details
Cornulin (A-3) AC
sc-514602 AC 500 µg/mL - 25% ag

Cornulin (A-3) AC

Sign In for Pricing
View Details
MAP3K7IP3 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62098R-PerCP-Cy5.5 100 µL

MAP3K7IP3 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details