Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli lpp protein

This E. coli lpp protein spans the amino acid sequence from region 21-78aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Braun lipoprotein (Murein-lipoprotein) (mlpA) (mulI)

UniProt

P69776

Expression Region

21-78aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CSPS (SuLT1A3) (NM_001017387) AAV Particle
RC219331A1V 250 µL

Human CSPS (SuLT1A3) (NM_001017387) AAV Particle

Sign In for Pricing
View Details
PRR25 (NM_001013638) Human Untagged Clone
SC301813 10 µg

PRR25 (NM_001013638) Human Untagged Clone

Sign In for Pricing
View Details
HMI sgRNA CRISPR Lentivector (Human) (Target 3)
K0974304 1.0 µg DNA

HMI sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HLTF Human Pre-designed siRNA Set A
HY-RS06220 1 Set

HLTF Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Mouse Outcome predictor in acute leukemia 1 homolog (Opal1)
MBS7024495-01 0.02 mg

Recombinant Mouse Outcome predictor in acute leukemia 1 homolog (Opal1)

Sign In for Pricing
View Details
Recombinant Mouse Outcome predictor in acute leukemia 1 homolog (Opal1)
MBS7024495-02 0.1 mg

Recombinant Mouse Outcome predictor in acute leukemia 1 homolog (Opal1)

Sign In for Pricing
View Details