Rat Sost protein
This Rat Sost protein spans the amino acid sequence from region 29-213aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sost, Sclerostin
UniProt
Q99P67
Expression Region
29-213aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Rattus norvegicus (Rat)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2103495-01 5x 96 Tests
Human Gamma-Aminobutyric Acid A Receptor Alpha 2 (gABRa2) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2103495-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)
Human Gamma-Aminobutyric Acid A Receptor Alpha 2 (gABRa2) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2103495-03 10x 96 Tests
Human Gamma-Aminobutyric Acid A Receptor Alpha 2 (gABRa2) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details MBS2103495-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)
Human Gamma-Aminobutyric Acid A Receptor Alpha 2 (gABRa2) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details