Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria BQ2027_MB3645C protein

This Bacteria BQ2027_MB3645C protein spans the amino acid sequence from region 1-103aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BQ2027_MB3645CEspC protein homolog

UniProt

P65088

Expression Region

1-103aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKR1D1 (NM_001190907) Human Over-expression Lysate
LC434132 20 µg

AKR1D1 (NM_001190907) Human Over-expression Lysate

Sign In for Pricing
View Details
iFluor™ 488 Conjugated human CD45 Recombinant Mouse Monoclonal Antibody [PSH03-64]
HA600109F 100 Tests

iFluor™ 488 Conjugated human CD45 Recombinant Mouse Monoclonal Antibody [PSH03-64]

Sign In for Pricing
View Details
GRHL3 Mouse Monoclonal Antibody [Clone ID: OTI5F3]
CF810684 100 µg

GRHL3 Mouse Monoclonal Antibody [Clone ID: OTI5F3]

Sign In for Pricing
View Details
Eliglustat Tartrate
TRC-E508025-25MG 25 mg

Eliglustat Tartrate

Sign In for Pricing
View Details
Macrod2 (NM_028387) Mouse Tagged ORF Clone
MG200464 10 µg

Macrod2 (NM_028387) Mouse Tagged ORF Clone

Sign In for Pricing
View Details