Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria BQ2027_MB3645C protein

This Bacteria BQ2027_MB3645C protein spans the amino acid sequence from region 1-103aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BQ2027_MB3645CEspC protein homolog

UniProt

P65088

Expression Region

1-103aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQFNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDGLFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREB1 pSer129 Rabbit Polyclonal Antibody
AP20859PU-N 100 µg

CREB1 pSer129 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human NAP1 (NAA25) activation kit by CRISPRa
GA112792 1 Kit

Human NAP1 (NAA25) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501116 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
XPNPEP1 Human qPCR Primer Pair (NM_020383)
HP226030 200 Reactions

XPNPEP1 Human qPCR Primer Pair (NM_020383)

Sign In for Pricing
View Details
IL2 Antibody
KC-338-01 50 μL

IL2 Antibody

Sign In for Pricing
View Details
IL2 Antibody
KC-338-02 100 µL

IL2 Antibody

Sign In for Pricing
View Details