Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HBG2 protein

This Human HBG2 protein spans the amino acid sequence from region 2-147aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)

UniProt

P69892

Expression Region

2-147aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM18 Protein Vector (Rat) (pPM-C-HA)
PV298416 500 ng

RBM18 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Rat FCGRT & B2M Heterodimer Protein
PKSR030131 100 µg

Recombinant Rat FCGRT & B2M Heterodimer Protein

Sign In for Pricing
View Details
Rabbit MRCKalpha Antibody
orb1526164-01 10 µL

Rabbit MRCKalpha Antibody

Sign In for Pricing
View Details
Rabbit MRCKalpha Antibody
orb1526164-02 100 µL

Rabbit MRCKalpha Antibody

Sign In for Pricing
View Details
DUSP1 Recombinant Protein (Human)
RP055668 100 µg

DUSP1 Recombinant Protein (Human)

Sign In for Pricing
View Details
P63 Mouse Monoclonal Antibody (BF680)
orb2367667 100 µL

P63 Mouse Monoclonal Antibody (BF680)

Sign In for Pricing
View Details