Bacteria HSP100 protein
This Bacteria HSP100 protein spans the amino acid sequence from region 1-138aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Protein CLP
UniProt
O15885
Expression Region
1-138aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Trypanosoma cruzi
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
NSPKGLEATREKVWQVVRSYFRPEFLNRLDDIVLFRRLGFGELHEIIDLIVAEVNGRLRSQDILLEVTDEAKNFVLENAFDAEMGARPLRRWVEKYITTEVSRMILAQQLPPNSTVRVLVNGSQGKLAFSVKRSFVSE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740523-500 1x 500 µL
AFP (Alpha Fetoprotein) (C2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682251-500 1x 500 µL
8-Oxoguanine DNA Glycosylase (CPTC-OGG1-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC943022-500 1x 500 µL
MerTK (Innate Immune Checkpoint) (MERTK/3022), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681219-100 1x 100 µL
Cytokeratin 8 (B22.1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942598-500 1x 500 µL
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details