Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria HSP100 protein

This Bacteria HSP100 protein spans the amino acid sequence from region 1-138aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein CLP

UniProt

O15885

Expression Region

1-138aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Trypanosoma cruzi

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSPKGLEATREKVWQVVRSYFRPEFLNRLDDIVLFRRLGFGELHEIIDLIVAEVNGRLRSQDILLEVTDEAKNFVLENAFDAEMGARPLRRWVEKYITTEVSRMILAQQLPPNSTVRVLVNGSQGKLAFSVKRSFVSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTX4 (NM_001300727) Human Tagged ORF Clone
RG238652 10 µg

DTX4 (NM_001300727) Human Tagged ORF Clone

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF568 conjugate, 0.1mg/mL
BNC683257-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3257), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LCMT1 (NM_001032391) Human Over-expression Lysate
LC422323 20 µg

LCMT1 (NM_001032391) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Arl10 activation kit by CRISPRa
GA206097 1 Kit

Mouse Arl10 activation kit by CRISPRa

Sign In for Pricing
View Details
LIX1 (NM_153234) Human Recombinant Protein
TP306319M 100 µg

LIX1 (NM_153234) Human Recombinant Protein

Sign In for Pricing
View Details
3-(1-Naphthyl)propionic Acid
TRC-N373163-25MG 25 mg

3-(1-Naphthyl)propionic Acid

Sign In for Pricing
View Details