Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOB protein

This Human APOB protein spans the amino acid sequence from region 28-127aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apo B-100 (Apo B-48)

UniProt

P04114

Expression Region

28-127aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM1 siRNA (Human)
orb1865335-01 15 nmol

TRPM1 siRNA (Human)

Sign In for Pricing
View Details
TRPM1 siRNA (Human)
orb1865335-02 30 nmol

TRPM1 siRNA (Human)

Sign In for Pricing
View Details
Bovine AP-2 complex subunit beta (AP2B1) ELISA Kit
MBS7215938-01 48 Well

Bovine AP-2 complex subunit beta (AP2B1) ELISA Kit

Sign In for Pricing
View Details
Bovine AP-2 complex subunit beta (AP2B1) ELISA Kit
MBS7215938-02 96 Well

Bovine AP-2 complex subunit beta (AP2B1) ELISA Kit

Sign In for Pricing
View Details
Bovine AP-2 complex subunit beta (AP2B1) ELISA Kit
MBS7215938-03 5x 96 Well

Bovine AP-2 complex subunit beta (AP2B1) ELISA Kit

Sign In for Pricing
View Details
Bovine AP-2 complex subunit beta (AP2B1) ELISA Kit
MBS7215938-04 10x 96 Well

Bovine AP-2 complex subunit beta (AP2B1) ELISA Kit

Sign In for Pricing
View Details