Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOB protein

This Human APOB protein spans the amino acid sequence from region 28-127aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apo B-100 (Apo B-48)

UniProt

P04114

Expression Region

28-127aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC46A3 knockout cell line
ABC-KH14133 1 Vial

Human SLC46A3 knockout cell line

Sign In for Pricing
View Details
CRNN antibody
70R-16597 50 ul

CRNN antibody

Sign In for Pricing
View Details
PIC 603-DIA 100-B7525 AC Signs
257927 Card of 1 Pictogram(s)

PIC 603-DIA 100-B7525 AC Signs

Sign In for Pricing
View Details
ACTH Recombinant Antibody, APC-Cy7 Conjugated
bsm-60798R-APC-Cy7 100 µL

ACTH Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
FTL Protein Lysate (Human) with C-Ha Tag
21028032 100 µg

FTL Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MiniPig Thymus Total Protein
NT-702 1 mg

MiniPig Thymus Total Protein

Sign In for Pricing
View Details