Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOB protein

This Human APOB protein spans the amino acid sequence from region 28-127aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apo B-100 (Apo B-48)

UniProt

P04114

Expression Region

28-127aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gabbr2 3'UTR Luciferase Stable Cell Line
TU106838 1.0 mL

Gabbr2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Olfr1386 (NM_001011741) Mouse Tagged ORF Clone Lentiviral Particle
MR215524L3V 200 µL

Olfr1386 (NM_001011741) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
H671_3g9701 Antibody (FITC)
orb350395-01 50 µg

H671_3g9701 Antibody (FITC)

Sign In for Pricing
View Details
H671_3g9701 Antibody (FITC)
orb350395-02 100 µg

H671_3g9701 Antibody (FITC)

Sign In for Pricing
View Details
NDUFB11 Human Over-expression Lysate
orb1340729 100 µg

NDUFB11 Human Over-expression Lysate

Sign In for Pricing
View Details
LTV1 Recombinant Protein Antigen
NBP1-86734PEP 0.1 mL

LTV1 Recombinant Protein Antigen

Sign In for Pricing
View Details