Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDGF B protein

This Human PDGF B protein spans the amino acid sequence from region 82-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PDGF-2 (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide) (Proto-oncogene c-Sis) (Becaplermin) (PDGF subunit B) (PDGF2) (SIS)

UniProt

P01127

Expression Region

82-190aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Elephantid herpesvirus 1 Protein ORF C, partial
MBS1467355 Inquire

Recombinant Elephantid herpesvirus 1 Protein ORF C, partial

Sign In for Pricing
View Details
Recombinant Human SAR1B Protein, N-His
YHN36101 100 μg

Recombinant Human SAR1B Protein, N-His

Sign In for Pricing
View Details
APOL2 Antibody - middle region : FITC (ARP49974_P050-FITC)
ARP49974_P050-FITC 100 µL

APOL2 Antibody - middle region : FITC (ARP49974_P050-FITC)

Sign In for Pricing
View Details
Recombinant Human EIF3M Protein, N-His
bs-102834P-01 20 µg

Recombinant Human EIF3M Protein, N-His

Sign In for Pricing
View Details
Recombinant Human EIF3M Protein, N-His
bs-102834P-02 50 µg

Recombinant Human EIF3M Protein, N-His

Sign In for Pricing
View Details
Acetamoren
JH919496 1 Each

Acetamoren

Sign In for Pricing
View Details