Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDGF B protein

This Human PDGF B protein spans the amino acid sequence from region 82-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PDGF-2 (Platelet-derived growth factor B chain) (Platelet-derived growth factor beta polypeptide) (Proto-oncogene c-Sis) (Becaplermin) (PDGF subunit B) (PDGF2) (SIS)

UniProt

P01127

Expression Region

82-190aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDHD Rabbit Polyclonal Antibody (Fluoro594)
orb3095531 100 µg

LDHD Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 2-isopropylmalate synthase (leuA), partial
MBS1191201 Inquire

Recombinant Salmonella enteritidis PT4 2-isopropylmalate synthase (leuA), partial

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae queA Protein (aa 1-356)
VAng-Lsx07511-50gEcoli 50 µg (E. coli)

Recombinant Shigella Dysenteriae queA Protein (aa 1-356)

Sign In for Pricing
View Details
Aspartate beta hydroxylase (ASPH) (NM_001164753) Human Tagged ORF Clone
RG228193 10 µg

Aspartate beta hydroxylase (ASPH) (NM_001164753) Human Tagged ORF Clone

Sign In for Pricing
View Details
OriCell™ MC38 Mouse Colon Cancer Cell Line with RFP
M1-0404 1x 10^6/Vial

OriCell™ MC38 Mouse Colon Cancer Cell Line with RFP

Sign In for Pricing
View Details
OR4C46 Recombinant Protein (Human)
RP080241 100 µg

OR4C46 Recombinant Protein (Human)

Sign In for Pricing
View Details