Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Cyprinus carpio Granulin-3 protein

This Fish Cyprinus carpio Granulin-3 protein spans the amino acid sequence from region 1-57aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granulin-3

UniProt

P81015

Expression Region

1-57aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Cyprinus carpio (Common carp)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVFCDAGITCPSGTTCCRSPFGVWYCCPFLMGQCCRDGRHCCRHGYHCDSTSTLCLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf76 (LRRC75A) (NM_001113567) Human Recombinant Protein
TP325515L 1 mg

C17orf76 (LRRC75A) (NM_001113567) Human Recombinant Protein

Sign In for Pricing
View Details
SIRT6 (Sirtuin 6, SIR2L6)
368928 100 µL

SIRT6 (Sirtuin 6, SIR2L6)

Sign In for Pricing
View Details
2-[4-(2',4'-Dichloro-5'-hydroxyphenoxy)phenoxy]propionic Acid Sodium Salt
TRC-D434685-2.5MG 2.5 mg

2-[4-(2',4'-Dichloro-5'-hydroxyphenoxy)phenoxy]propionic Acid Sodium Salt

Sign In for Pricing
View Details
Mouse Monoclonal MMP-13 Antibody (OTI2D8) [DyLight 550]
NBP2-72740R 0.1 mL

Mouse Monoclonal MMP-13 Antibody (OTI2D8) [DyLight 550]

Sign In for Pricing
View Details
SDR42E1 (NM_145168) Human Tagged ORF Clone
RC215485 10 µg

SDR42E1 (NM_145168) Human Tagged ORF Clone

Sign In for Pricing
View Details
Bovine Centromere Protein X (STRA13) ELISA Kit
MBS7263584-01 48 Well

Bovine Centromere Protein X (STRA13) ELISA Kit

Sign In for Pricing
View Details