Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish Cyprinus carpio Granulin-3 protein

This Fish Cyprinus carpio Granulin-3 protein spans the amino acid sequence from region 1-57aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Granulin-3

UniProt

P81015

Expression Region

1-57aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Cyprinus carpio (Common carp)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VVFCDAGITCPSGTTCCRSPFGVWYCCPFLMGQCCRDGRHCCRHGYHCDSTSTLCLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB3 Antibody
orb1320419 100 µL

SERPINB3 Antibody

Sign In for Pricing
View Details
Goat Anti-Mouse IgM - FITC
CSA2348-01 100 µL

Goat Anti-Mouse IgM - FITC

Sign In for Pricing
View Details
Goat Anti-Mouse IgM - FITC
CSA2348-02 500 μL

Goat Anti-Mouse IgM - FITC

Sign In for Pricing
View Details
Goat Anti-Mouse IgM - FITC
CSA2348-03 1 mL

Goat Anti-Mouse IgM - FITC

Sign In for Pricing
View Details
Bovine Telomerase (TE) ELISA Kit
MBS281594-01 48 Tests

Bovine Telomerase (TE) ELISA Kit

Sign In for Pricing
View Details
Bovine Telomerase (TE) ELISA Kit
MBS281594-02 96 Tests

Bovine Telomerase (TE) ELISA Kit

Sign In for Pricing
View Details