Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnmd protein

This Mouse Tnmd protein spans the amino acid sequence from region 51-317aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chondromodulin-1-like protein (ChM1L) (mChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin) (TeM) (mTeM) (Chm1l)

UniProt

Q9EP64

Expression Region

51-317aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Cytochrome P450 1B1 (Cyp1b1)
orb1650278-01 20 µg

Recombinant Rat Cytochrome P450 1B1 (Cyp1b1)

Sign In for Pricing
View Details
Recombinant Rat Cytochrome P450 1B1 (Cyp1b1)
orb1650278-02 100 µg

Recombinant Rat Cytochrome P450 1B1 (Cyp1b1)

Sign In for Pricing
View Details
Recombinant Rat Cytochrome P450 1B1 (Cyp1b1)
orb1650278-03 1 mg

Recombinant Rat Cytochrome P450 1B1 (Cyp1b1)

Sign In for Pricing
View Details
Sophora japonica (SJA, Pagoda Tree) (AP)
S5362-05A 1 mg

Sophora japonica (SJA, Pagoda Tree) (AP)

Sign In for Pricing
View Details
Zinc decanoate
orb1694689 25 mg

Zinc decanoate

Sign In for Pricing
View Details
PDE3B Knockout Cell Lysate
ABC-KC1421 100 µg

PDE3B Knockout Cell Lysate

Sign In for Pricing
View Details