Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tnmd protein

This Mouse Tnmd protein spans the amino acid sequence from region 51-317aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chondromodulin-1-like protein (ChM1L) (mChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin) (TeM) (mTeM) (Chm1l)

UniProt

Q9EP64

Expression Region

51-317aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadmium Chloride Monohydrate 98% Extrapure
00602 00500 500 g

Cadmium Chloride Monohydrate 98% Extrapure

Sign In for Pricing
View Details
Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit
E-CL-H0108-01 24 Tests

Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit

Sign In for Pricing
View Details
Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit
E-CL-H0108-02 48 Tests

Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit

Sign In for Pricing
View Details
Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit
E-CL-H0108-03 96 Tests

Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit

Sign In for Pricing
View Details
rno-miR-423-3p Primers
MPR00690 150 µL / 10 µM

rno-miR-423-3p Primers

Sign In for Pricing
View Details
Anti-Cav1.2/1.3 Ca2+ channel Antibody (L57/23)
MBS1571470-01 0.1 mg

Anti-Cav1.2/1.3 Ca2+ channel Antibody (L57/23)

Sign In for Pricing
View Details