Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus F protein

This Virus F protein spans the amino acid sequence from region 27-529aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein F

UniProt

P03420

Expression Region

27-529aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human respiratory syncytial virus A (strain A2)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EHHADH Antibody
8C17622-AAT 50 µg

EHHADH Antibody

Sign In for Pricing
View Details
iFluor™ 594 Conjugated Sodium Potassium ATPase Recombinant Rabbit Monoclonal Antibody [ST0533]
HA720175F 100 µL

iFluor™ 594 Conjugated Sodium Potassium ATPase Recombinant Rabbit Monoclonal Antibody [ST0533]

Sign In for Pricing
View Details
POT1 Rabbit Polyclonal Antibody
TA361198 100 µL

POT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Heat Shock 27kDa Protein 1 (HPS27) (CPTC-HSPB1-2), CF568 conjugate, 0.1mg/mL
BNC682244-500 1x 500 µL

Heat Shock 27kDa Protein 1 (HPS27) (CPTC-HSPB1-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (PD7/26), CF647 conjugate, 0.1mg/mL
BNC470472-100 1x 100 µL

CD45RB (PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Datura stramonium Lectin (Jimson Weed) -DSA-,  40nm
GP-5701-40 1 mL

Colloidal Gold Conjugated Datura stramonium Lectin (Jimson Weed) -DSA-, 40nm

Sign In for Pricing
View Details