Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus F protein

This Virus F protein spans the amino acid sequence from region 27-529aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein F

UniProt

P03420

Expression Region

27-529aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human respiratory syncytial virus A (strain A2)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FNDC8 (NM_017559) Human Recombinant Protein
TP305252M 100 µg

FNDC8 (NM_017559) Human Recombinant Protein

Sign In for Pricing
View Details
Daprodustat
TRC-D193368-25MG 25 mg

Daprodustat

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS714727 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR561422 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Acetyl Propionate
TRC-A167668-50MG 50 mg

Acetyl Propionate

Sign In for Pricing
View Details
TGFBR3L Human Gene Knockout Kit (CRISPR)
KN431159 1 Kit

TGFBR3L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details